PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P02420_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 874aa    MW: 95278.8 Da    PI: 6.5396
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P02420_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-182683457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr5P02420_001 26 YVRYTPEQVEALERVYTECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 83
                           6789****************************************************97 PP

2START167.77.9e-531944022205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++  v+++l+d++ W  +++  e+l vi +g 
  GSMUA_Achr5P02420_001 194 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPT-KVADILKDRPSWYCDCRCLEVLTVIPTGn 280
                            68999*****************************************************.9999999999******************* PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g ++l++++++a+++l++ Rdf+++Ry+  l++g++vi+++S+++ +  p     +++vRae+l Sg+li+p+++g+s +++v+hvd
  GSMUA_Achr5P02420_001 281 gGNIELIYMQTYAPTTLAAaRDFWTLRYTTGLEDGSLVICERSLTPVTGGPAgppAPNFVRAEMLSSGYLIRPCEGGGSMIHIVDHVD 368
                            ***********************************************99998889********************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l++++++++lr+l++s  + ++k++va+l+++++
  GSMUA_Achr5P02420_001 369 LDAWSVPEVLRPLYESPKILAQKMTVAALRHLKQ 402
                            *****************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-18883IPR009057Homeodomain-like
PROSITE profilePS5007115.3862084IPR001356Homeobox domain
SMARTSM003896.3E-152288IPR001356Homeobox domain
CDDcd000864.27E-162585No hitNo description
SuperFamilySSF466892.18E-162587IPR009057Homeodomain-like
PfamPF000466.6E-162683IPR001356Homeobox domain
CDDcd146861.86E-677116No hitNo description
PROSITE profilePS5084824.554184412IPR002913START domain
CDDcd088754.91E-68188404No hitNo description
Gene3DG3DSA:3.30.530.201.4E-23192396IPR023393START-like domain
SMARTSM002341.3E-49193403IPR002913START domain
SuperFamilySSF559619.06E-40194405No hitNo description
PfamPF018521.8E-50194402IPR002913START domain
SuperFamilySSF559619.2E-5442523No hitNo description
SuperFamilySSF559619.2E-5556630No hitNo description
PfamPF086707.9E-50731873IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 874 aa     Download sequence    Send to blast
MAMVVSGKEA GKGQQAAAAG MDAGKYVRYT PEQVEALERV YTECPKPSSL RRQQLIRECP  60
ILSNIEPKQI KVWFQNRRCR EKQRKEASRL QTVNRKLTAM NKLLMEENDR LQKQVSQLVY  120
ENGYMRQQLH NVSVHVARFL KYACFHVIHS YAPVATNDTS CESVVTSGQH HHQQNPTPQR  180
PQKDANNPAG LLAIAEETLA EFLSKATGTA VDWVQMVGMK PGPDSIGIIA VSHNCSGVAA  240
RACGLVSLEP TKVADILKDR PSWYCDCRCL EVLTVIPTGN GGNIELIYMQ TYAPTTLAAA  300
RDFWTLRYTT GLEDGSLVIC ERSLTPVTGG PAGPPAPNFV RAEMLSSGYL IRPCEGGGSM  360
IHIVDHVDLD AWSVPEVLRP LYESPKILAQ KMTVAALRHL KQIAQETSGE VPYGSGRRPA  420
VLRTFSQRLS RGFNDAVNGF VDDGWSLLGS DGVEDVTVAI NSSPNKILSS HANTSAVFST  480
LGGGVLCAKA SMLLQNVPPA ILVQFLREHR SEWADCGVDA YSAASLTANP YAVPAVRASG  540
GFLGSQVILP LAHTVEHEEF LEVIRLEGHG FNQDDVILSR DMYFLQLCSG VDENAVGACA  600
QLVFAPIDES FADDVPLLPS GFRVTPLDPK TDSPAATRTL DLASTLEIGS GVTARAVNET  660
ASSTYNLRSV LTIAFQFTYE NHLRDSVAEM ARQYVRNVVA SVQRVAMAIA PSRPGSQIGV  720
KHPPGSPEAH TLAQWISGSY RAHTGGDLLR VDSQASDLLL KLLWHHSDAI MCCSLKASPV  780
LTFSNQAGLD MLETTLIALQ DIALEKILDD SARKVLCSEF PKIMQQGLAY LPAGICLSSM  840
GRPVSYEQAV AWKVLNEEDT THCLAFMFVN WSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399045.10.0PREDICTED: homeobox-leucine zipper protein HOX32
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0SV210.0M0SV21_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P02420_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein